PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.11G026000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family LBD
Protein Properties Length: 248aa    MW: 28338.8 Da    PI: 4.8965
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.11G026000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260131.43.8e-41171161100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          aCaaCk++rrkCa+dC+lapyfp++++++f n+hklFG+sn++k++k+l+++++++am+++++++++ra+dPv G++++i++lq+q+e +
  Manes.11G026000.1.p  17 ACAACKYQRRKCAPDCILAPYFPHDRQRQFLNAHKLFGVSNITKIIKNLNQTDKDEAMRTIIFQSDVRANDPVGGCYRIIRELQRQIEYH 106
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          kael+l+ ++
  Manes.11G026000.1.p 107 KAELDLVLHQ 116
                          ****998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575118No hitNo description
PROSITE profilePS5089125.03816117IPR004883Lateral organ boundaries, LOB
PfamPF031955.0E-3817113IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MSNPRIGNGN GNGTSQACAA CKYQRRKCAP DCILAPYFPH DRQRQFLNAH KLFGVSNITK  60
IIKNLNQTDK DEAMRTIIFQ SDVRANDPVG GCYRIIRELQ RQIEYHKAEL DLVLHQLAIC  120
RAQAQQQTHF QMLETDDSTT LGCEILNPDS LDVYDPTMIQ YHYPQTQEEE EQGFVIQDHN  180
QKLQENVDEA LPIQDSTSSP SLHDFKQHFV KECDDIKPLL DINDVKFEPE ELVERQLVPL  240
TQLVISS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002527399.11e-125PREDICTED: LOB domain-containing protein 22
SwissprotQ9LRW17e-70LBD22_ARATH; LOB domain-containing protein 22
TrEMBLB9SN301e-125B9SN30_RICCO; LOB domain-containing protein, putative
STRINGPOPTR_0003s04520.13e-76(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41333259
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.14e-71LOB domain-containing protein 22